> Last Item Added:
0 Items

Ordering Information

  • : 06-182
  • : 100 μg
  • : 0.5 mg/mL
  • View Alternate Pack Size or Formats
  • Related Products
  • Product Family Information

Product Images

WB: NIH 3T3 cell lysate probed with anti-MAP Kinase 1/2 (0.5µg/ml)

Immunofluorescnce: 2µg/ml of this lot showed positive immunostaining for MAP kinases in A431 cells.

Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT | 06-182

Species Reactivity Key Applications Host Format Antibody Type
Av, H, M, R, Sh, Xn, Ech ICC, IP, WB Rabbit Affinity Purified Polyclonal Antibody
Description:
Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT | 06-182
Promotional Text:
Trade Name:
Upstate (Millipore)
Specificity:
Recognizes MAPK1/Erk1 and MAPK2/Erk2.
Molecular Weight:
MAPK1/Erk1 (44 kDa) and MAPK2/Erk2 (42 kDa)
Immunogen:
38 residue synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2
Isotype:
Background Information:
The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase. The ERK1/2 signaling cascade has been shown to be a critical regulator of cell differentiation, cell physiology and neuronal function. Aberrant control of ERK1/2 activity has been implicated in a variety of pathological conditions, including cancer and autoimmune diseases, and efficient study methods are in demand.
Species Reactivity:
  • Avian
  • Human
  • Mouse
  • Rat
  • Sheep
  • Xenopus
  • Echinoderms
Control:
Positive Control Included: 3T3 Cell Lysate (12-305)
Quality Assurance:
routinely evaluated by immunoblot on mouse 3T3/A31 fibroblasts, rat L6 cells or human A431 carcinoma cells
Purification Method:
Immunoaffinity purified
Presentation:
Immunoaffinity purified immunoglobulin in 0.07M Tris-glycine, pH 7.4, 0.105 M NaCl, 0.035% sodium azide as a preservative.
Storage Conditions:
Maintain for 1 year at -20°C from date of shipment. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
UniProt Number:
Entrez Gene Number:
Gene Symbol:
  • MAPK1
  • p38
  • ERK
  • P42MAPK
  • ERK2
  • p40
  • PRKM1
  • p41mapk
  • PRKM2
  • MAPK2
  • p42-MAPK
  • p41
  • ERK-2
  • ERT1
Usage Statement:
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Key Applications:
  • Immunocytochemistry
  • Immunoprecipitation
  • Western Blotting
Entrez Gene Summary:
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
UniProt Summary:
FUNCTION: SwissProt: P28482 # Involved in both the initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors such as ELK1. Phosphorylates EIF4EBP1; required for initiation of translation. Phosphorylates microtubule-associated protein 2 (MAP2). Phosphorylates SPZ1 (By similarity). Phosphorylates heat shock factor protein 4 (HSF4).
COFACTOR: Magnesium (By similarity).
SIZE: 360 amino acids; 41390 Da
SUBUNIT: Interacts with MORG1 (By similarity). Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine- kinase activity. Interacts with HSF4.
DOMAIN: SwissProt: P28482 The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
PTM: Dually phosphorylated on Thr-185 and Tyr-187, which activates the enzyme.
SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. & Contains 1 protein kinase domain.
Brand Family:
Upstate
Product Name:
Anti-MAP Kinase 1/2 (Erk1/2) Antibody, CT | 06-182
Concentration:
0.5 mg/mL
Antibody Type:
Polyclonal Antibody
Qty/Pk:
100 μg
Format:
Affinity Purified
Host:
Rabbit

Product Resources

Compatible Secondary Antibodies

Select the host, conjugate, and species, and then press Search to find the secondary antibodies for your research needs.